PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004486969.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MYB
Protein Properties Length: 311aa    MW: 35876 Da    PI: 6.5172
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004486969.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.3e-152269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ede+l ++  + G g+W+ +a+  g+ R++k+c++rw +yl
   XP_004486969.1 22 KGLWSPDEDEKLMNYMVKNGQGCWSDVAKNAGLQRCGKSCRLRWINYL 69
                     678*******************************************97 PP

2Myb_DNA-binding49.87.7e-1675118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E++l+++ + +lG++ W+ Ia++++ gRt++++k++w++
   XP_004486969.1  75 RGAFSPQEEQLIIHFHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 118
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-231572IPR009057Homeodomain-like
PROSITE profilePS5129417.2341769IPR017930Myb domain
SuperFamilySSF466892.5E-2820116IPR009057Homeodomain-like
SMARTSM007176.3E-112171IPR001005SANT/Myb domain
PfamPF002494.3E-142269IPR001005SANT/Myb domain
CDDcd001674.31E-92569No hitNo description
PROSITE profilePS5129425.55770124IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2573125IPR009057Homeodomain-like
SMARTSM007172.8E-1574122IPR001005SANT/Myb domain
PfamPF002496.7E-1575118IPR001005SANT/Myb domain
CDDcd001672.24E-1077117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MRKPEVCSKN KNDNKKKIKL RKGLWSPDED EKLMNYMVKN GQGCWSDVAK NAGLQRCGKS  60
CRLRWINYLR PDLKRGAFSP QEEQLIIHFH SLLGNRWSQI AARLPGRTDN EIKNFWNSTI  120
KKKLKNLSST TTSTSPNASD SSSPEPNKEL NINVSSQHAN YYNYMNMPMF TSSPLSMQNR  180
VFNTMNIDTL PMPTPIEYDG YLSQIGVDSY LLENAVFGSV NINGVEEDVF VPNSLENTNT  240
NTNHHNLRVE NTCKRETYNN SDYYFDHINS NYNIDDQNRG EVVENLFQEE FNLGEWGFEE  300
LMKDVSSFLF S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-282012425128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1463306e-72AC146330.33 Medicago truncatula clone mth2-7g7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004486969.10.0PREDICTED: transcription factor MYB46-like
TrEMBLG7IS011e-134G7IS01_MEDTR; Myb transcription factor
STRINGGLYMA11G14200.21e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.12e-62myb domain protein 46